NearSpotUSA Add

Categories Locations Saved Add Sign in

Find local businesses in every city and ZIP code across the United States.

Explore

All categories
Browse by state
Search listings
About / data sources

For businesses

Add your business
My listings
Business admin

Your account

Sign in
Saved places
Account

Business data from Overture Maps Foundation (CDLA-Permissive 2.0), the IRS Exempt Organizations BMF (public domain), and OpenStreetMap (© OpenStreetMap contributors, ODbL) — which also provides the map tiles. ZIP code and city data from GeoNames (CC BY 4.0).

© 2026 NearSpotUSA.

Furniture & Home Decor in Broken Bow, OK | NearSpotUSA

Home/Oklahoma/Broken Bow/Furniture & Home Decor

Furniture & Home Decor in Broken Bow, OK

15

Showing 10 on this page · 10 on the map

Loading map…

Perfectly Imperfect Vintage Marketplace & Boutique

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

1729 N US Highway 259, 74728

+15805798941 perfectlyimperfectvintagemarketplace.com

Once Upon A Time

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

4836 N US Hwy 259, 74728

Tag Agent

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

32 N Main St, 74728

+15805842892 www.ok.gov

The Forest Store Hochatown

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

6427 N US Hwy 259, 74728

The Antique Roost

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

1504 S Park Dr, 74728

Tidwell Furniture and Decor

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

4994 S Park Dr, 74728

Timber Valley Rustic Furniture

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

2332 US-70, 74728

+15805847878 Timbervalleyrustics.com

The Green Muse Gifts

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

1798 N US Highway 259, 74728

The Strip at Hochatown Market South

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

24 Crooked Oaks Ln, 74728

River Man Trading Post

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

113 W 1st St, 74728

15802369026 river-man-trading-post.business.site

Furniture & Home Decor in other Oklahoma cities

Furniture & Home Decor in Oklahoma City486 Furniture & Home Decor in Tulsa392 Furniture & Home Decor in Edmond128 Furniture & Home Decor in Bethany114 Furniture & Home Decor in Broken Arrow99 Furniture & Home Decor in Norman86 Furniture & Home Decor in Lawton70 Furniture & Home Decor in Muskogee55 Furniture & Home Decor in Stillwater55 Furniture & Home Decor in Shawnee46 Furniture & Home Decor in Jenks44

More in Broken Bow, OK

Hotels & Lodging691 Landmarks & Historic Sites92 Restaurants68 Churches51 Parks & Trails46 Real Estate Agents39 Transportation & Shipping34 Clothing & Apparel33 Non-Profits & Charities33 Sports & Recreation31 Bars & Pubs29 Florists & Gifts

Furniture & Home Decor in Claremore39

27