NearSpotUSA Add

Categories Locations Saved Add Sign in

Find local businesses in every city and ZIP code across the United States.

Explore

All categories
Browse by state
Search listings
About / data sources

For businesses

Add your business
My listings
Business admin

Your account

Sign in
Saved places
Account

Business data from Overture Maps Foundation (CDLA-Permissive 2.0), the IRS Exempt Organizations BMF (public domain), and OpenStreetMap (© OpenStreetMap contributors, ODbL) — which also provides the map tiles. ZIP code and city data from GeoNames (CC BY 4.0).

© 2026 NearSpotUSA.

The Antique Roost — Broken Bow, OK | NearSpotUSA

Home/Furniture & Home Decor/Broken Bow/74728

The Antique Roost

Furniture & Home Decor · Broken Bow, OK

No reviews yet

Call +15802360838 Directions

Loading map…

Reviews

Sign in to write a review.

No reviews yet — be the first to share your experience.

Contact

1504 S Park Dr, Broken Bow, OK 74728
+15802360838
[email protected]

Location

All listings in Broken Bow
All listings in 74728
All furniture & home decor

Is this your business? Claim or update this listing.

More furniture & home decor nearby

Perfectly Imperfect Vintage Marketplace & Boutique

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

1729 N US Highway 259, 74728

+15805798941 perfectlyimperfectvintagemarketplace.com

Tidwell Furniture and Decor

Call Directions

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

4994 S Park Dr, 74728

The Forest Store Hochatown

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

6427 N US Hwy 259, 74728

Once Upon A Time

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

4836 N US Hwy 259, 74728

Tag Agent

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

32 N Main St, 74728

+15805842892 www.ok.gov

Timber Valley Rustic Furniture

Furniture & Home Decor · Broken Bow, OK

Not yet reviewed

2332 US-70, 74728

+15805847878 Timbervalleyrustics.com