NearSpotUSA Add

Categories Locations Saved Add Sign in

Find local businesses in every city and ZIP code across the United States.

Explore

All categories
Browse by state
Search listings
About / data sources

For businesses

Add your business
My listings
Business admin

Your account

Sign in
Saved places
Account

Business data from Overture Maps Foundation (CDLA-Permissive 2.0), the IRS Exempt Organizations BMF (public domain), and OpenStreetMap (© OpenStreetMap contributors, ODbL) — which also provides the map tiles. ZIP code and city data from GeoNames (CC BY 4.0).

© 2026 NearSpotUSA.

Local businesses in 87121 (Albuquerque, NM) | NearSpotUSA

Home/New Mexico/Albuquerque/87121

Businesses in 87121

Albuquerque, New Mexico · Bernalillo County · 1,418 listings

What’s in this ZIP code

Auto Repair 97 Contractors & Builders 91 Banks & ATMs 87 Mexican 83 Transportation & Shipping 75 Restaurants 71 Landmarks & Historic Sites 68 Parks & Trails 61 Schools 52 Churches 51 Non-Profits & Charities 50 Electronics 43 Financial Advisors 43 Gas Stations 42 Hardware & Home Improvement 42 Car Dealers 40 Fast Food 38 Convenience Stores 31 Doctors & Clinics 30 Insurance 29 Hair Salons 29 Department & Discount Stores 28 Movers & Storage 27 Business Consulting 27

1,418 listings

Showing 10 on this page · 10 on the map

Loading map…

Western Union

Banks & ATMs · Albuquerque, NM

Not yet reviewed

514 Old Coors Dr SW, 87121

5058366434 locations.westernunion.com

A-1 Firewood and Landscaping Materials

Nursery & Garden · Albuquerque, NM

Not yet reviewed

3134 Bridge Blvd SW, 87121

(505) 242-8181 a1firewoodinc.com

Alex Pro Painting, Llc

Handyman & Repair · Albuquerque, NM

Not yet reviewed

3835 Flora Vista Ave SW, 87121

Cleaners of New Mexico

Dry Cleaning & Laundry · Albuquerque, NM

Not yet reviewed

859 Coors Blvd NW, 87121

+15053522565 www.cleanersofnm.com

Creative Beauty

Beauty Salons · Albuquerque, NM

Not yet reviewed

475 Coors Blvd NW, 87121

Group Auto Sales

Auto Repair · Albuquerque, NM

Not yet reviewed

701 Coors Blvd Nw Ste D6, 87121

Income Tax Express NM

Accountants & Tax · Albuquerque, NM

Not yet reviewed

10209 Guadiana Pl SW, 87121

5052889955 incometaxexpressnm.com

Star Paving

Contractors & Builders · Albuquerque, NM

Not yet reviewed

3109 Love Rd SW, 87121

+15058770380 www.starpaving.com

Valencia Valley Chimney Sweeping & Stove Sales

Cleaning Services · Albuquerque, NM

Not yet reviewed

11119 Red Robin Rd SW, 87121

(505) 459-5429 valenciavalleychimneysweeping.weebly.com

123 Child Development Center

Handyman & Repair · Albuquerque, NM

Not yet reviewed

3900 Las Estancias Ct #103, 87121

+15055822859 123childdevelopmentcenter.com

Previous 1…71 72 73 74 75…142 Next

Other ZIP codes in Albuquerque

87101 45 87102 2,893 87103 20 87104 956 87105 1,491 87106 2,178 87107 3,088 87108 1,971 87109 3,963 87110 4,509 87111 1,923 87112 1,909 87113 1,528 87114 2,177 87115

6