NearSpotUSA Add

Categories Locations Saved Add Sign in

Find local businesses in every city and ZIP code across the United States.

Explore

All categories
Browse by state
Search listings
About / data sources

For businesses

Add your business
My listings
Business admin

Your account

Sign in
Saved places
Account

Business data from Overture Maps Foundation (CDLA-Permissive 2.0), the IRS Exempt Organizations BMF (public domain), and OpenStreetMap (© OpenStreetMap contributors, ODbL) — which also provides the map tiles. ZIP code and city data from GeoNames (CC BY 4.0).

© 2026 NearSpotUSA.

Local businesses in 70501 (Lafayette, LA) | NearSpotUSA

Home/Louisiana/Lafayette/70501

Businesses in 70501

Lafayette, Louisiana · Lafayette County · 2,061 listings

What’s in this ZIP code

Lawyers & Legal 178 Non-Profits & Charities 161 Restaurants 136 Government Offices 95 Bars & Pubs 94 Schools 88 Churches 85 Auto Repair 80 Landmarks & Historic Sites 76 Hair Salons 71 Transportation & Shipping 71 Banks & ATMs 68 Financial Advisors 66 Doctors & Clinics 66 Hotels & Lodging 62 Clothing & Apparel 58 Business Consulting 55 Grocery Stores 51 Car Dealers 49 Real Estate Agents 47 Contractors & Builders 45 Religious Organizations 40 Books, Music & Hobbies 39 Insurance 36

Showing 10 on this page · 10 on the map

Loading map…

Our Lady Queen of Peace Catholic Church

Churches · Lafayette, LA

Not yet reviewed

145 Martin Luther King Jr Dr, 70501

+13372331591 www.queenofpeacelafayette.org

SIDES & Associates

Marketing & Design · Lafayette, LA

Not yet reviewed

222 Jefferson St, 70501

+13372336473 www.sides.com

Telly's Place

Restaurants · Lafayette, LA

Not yet reviewed

1941 Moss St, 70501

Blue Rhino Propane Exchange

Gas Stations · Lafayette, LA

Not yet reviewed

1818 Jefferson St, 70501

3372345253 bluerhino.com

Blue Rhino Propane Exchange

Gas Stations · Lafayette, LA

Not yet reviewed

1944 Moss St, 70501

3378068046 bluerhino.com

Blue Rhino Propane Exchange

Gas Stations · Lafayette, LA

Not yet reviewed

215 W Willow St, 70501

3375729340 bluerhino.com

Blue Rhino Propane Exchange

Gas Stations · Lafayette, LA

Not yet reviewed

501 E Pinhook Rd, 70501

3373264513 bluerhino.com

Camels Family Hair Stylings

Barbershops · Lafayette, LA

Not yet reviewed

1212 Mudd Ave, 70501

+13372341843 camelsfamilyhairstylings.placeweb.site

Cry Baby Tattoo - Downtown Lafayette

Tattoo & Piercing · Lafayette, LA

Not yet reviewed

535 Jefferson St, 70501

First Presbyterian Church

Churches · Lafayette, LA

Not yet reviewed

1130 Johnston St, 70501

+13372345182 www.fpclafayette.org

Previous 1…60 61 62 63 64…207 Next

Other ZIP codes in Lafayette

70501 2,061 70502 62 70503 2,887 70504 44 70505 105 70506 2,449 70507 756 70508 3,839 70509 45 70593 8 70596 35 70598 29

2,061 listings