NearSpotUSA Add

Categories Locations Saved Add Sign in

Find local businesses in every city and ZIP code across the United States.

Explore

All categories
Browse by state
Search listings
About / data sources

For businesses

Add your business
My listings
Business admin

Your account

Sign in
Saved places
Account

Business data from Overture Maps Foundation (CDLA-Permissive 2.0), the IRS Exempt Organizations BMF (public domain), and OpenStreetMap (© OpenStreetMap contributors, ODbL) — which also provides the map tiles. ZIP code and city data from GeoNames (CC BY 4.0).

© 2026 NearSpotUSA.

Local businesses in 29481 (Smoaks, SC) | NearSpotUSA

Home/South Carolina/Smoaks/29481

Businesses in 29481

Smoaks, South Carolina · Colleton County · 46 listings

What’s in this ZIP code

Churches 21 Non-Profits & Charities 4 Schools 4 BBQ 3 Farms & Agriculture 3 Transportation & Shipping 3 Government Offices 3 Landmarks & Historic Sites 2 Grocery Stores 2 Ski & Winter Sports 2 Post Offices 2 Contractors & Builders 2 Restaurants 2 Car Dealers 1 Parks & Trails 1 Hardware & Home Improvement 1 Juice & Smoothies 1 Convenience Stores 1 Community Centers 1 Fire & Police 1 Insurance 1 Bowling & Arcades 1 Real Estate Agents 1 Printing & Signs 1

Showing 2 on this page · 2 on the map

Loading map…

P & P Builders

Contractors & Builders · Smoaks, SC

Not yet reviewed

524 Jewel Ave, 29481

Leroy Williams Septic Tank Service

Contractors & Builders · Smoaks, SC

Not yet reviewed

487 Sizemore Rd, 29481

(843) 562-2895 leroywilliamsseptictankservices.placeweb.site

2 listings