NearSpotUSA Add

Categories Locations Saved Add Sign in

Find local businesses in every city and ZIP code across the United States.

Explore

All categories
Browse by state
Search listings
About / data sources

For businesses

Add your business
My listings
Business admin

Your account

Sign in
Saved places
Account

Business data from Overture Maps Foundation (CDLA-Permissive 2.0), the IRS Exempt Organizations BMF (public domain), and OpenStreetMap (© OpenStreetMap contributors, ODbL) — which also provides the map tiles. ZIP code and city data from GeoNames (CC BY 4.0).

© 2026 NearSpotUSA.

Cleaning Services in Albuquerque, NM | NearSpotUSA

Home/New Mexico/Albuquerque/Cleaning Services

Cleaning Services in Albuquerque, NM

163

Showing 10 on this page · 10 on the map

Loading map…

Jani-King Commercial Cleaning and Janitorial Services

Cleaning Services · Albuquerque, NM

Not yet reviewed

6604 Honeylocust Ave NW, 87121

5053411070 www.janiking.com

ABQ Power Sweeping

Cleaning Services · Albuquerque, NM

Not yet reviewed

2327 2nd St SW, 87102

+15058774272 abqpowersweeping.com

One World Rug Care | Area Rug Cleaning & Textile Care Specialist

Cleaning Services · Albuquerque, NM

Not yet reviewed

7200 Jefferson St NE Ste A, 87109

+15053932110 www.OneWorldRugCare.com

Rio Grande Clean Team

Cleaning Services · Albuquerque, NM

Not yet reviewed

110 2nd St SW Ste 608, 87102

(505) 333-8029 riograndecleanteam.com

Sandia Softwash LLC

Cleaning Services · Albuquerque, NM

Not yet reviewed

9512 Mesa Arriba Ct NE, 87111

+15054337277 sandiasoftwash.com

IW HomeSource

Cleaning Services · Albuquerque, NM

Not yet reviewed

6300 Riverside Plaza Ln NW, 100, 87120

5057982504 www.iwhomesource.com

PS Facility Maintenance

Cleaning Services · Albuquerque, NM

Not yet reviewed

501 General Somervell St SE Ste A, 87123

(505) 890-6993 www.facilitymaintenance.com

Carpet Masters of Albuquerque

Cleaning Services · Albuquerque, NM

Not yet reviewed

400 Central Ave SE, 87102

+15052650790 www.carpetmastersabq.com

Valencia Valley Chimney Sweeping & Stove Sales

Cleaning Services · Albuquerque, NM

Not yet reviewed

11119 Red Robin Rd SW, 87121

(505) 459-5429 valenciavalleychimneysweeping.weebly.com

ServiceMaster Clean

Cleaning Services · Albuquerque, NM

Not yet reviewed

2416 Candelaria Rd NE, 87107

+15054214291 www.servicemasterclean.com

Cleaning Services in other New Mexico cities

Cleaning Services in Santa Fe36 Cleaning Services in Las Cruces31

More in Albuquerque, NM

Non-Profits & Charities2,689 Doctors & Clinics2,010 Restaurants1,309 Real Estate Agents1,292 Auto Repair1,171 Transportation & Shipping1,083 Banks & ATMs1,044 Schools1,003 Lawyers & Legal987 Landmarks & Historic Sites987 Contractors & Builders939 Business Consulting

Previous 1…5 6 7 8 9…17 Next

921