NearSpotUSA Add

Categories Locations Saved Add Sign in

Find local businesses in every city and ZIP code across the United States.

Explore

All categories
Browse by state
Search listings
About / data sources

For businesses

Add your business
My listings
Business admin

Your account

Sign in
Saved places
Account

Business data from Overture Maps Foundation (CDLA-Permissive 2.0), the IRS Exempt Organizations BMF (public domain), and OpenStreetMap (© OpenStreetMap contributors, ODbL) — which also provides the map tiles. ZIP code and city data from GeoNames (CC BY 4.0).

© 2026 NearSpotUSA.

Local businesses in Mcgregor, MN | NearSpotUSA

Home/Minnesota/Mcgregor

Local businesses in Mcgregor, MN

217 listings · Aitkin County · 1 ZIP code

Popular categories here

Non-Profits & Charities 34 Bars & Pubs 14 Government Offices 9 Churches 9 Movers & Storage 8 Hotels & Lodging 8 Restaurants 7 Sports & Recreation 6 Schools 5 Contractors & Builders 5 Campgrounds & RV Parks 5 Gas Stations 4 Banks & ATMs 4 Parks & Trails 4 Farms & Agriculture 4 Auto Repair 3 Transportation & Shipping 3 Grocery Stores 3 Community Centers 3 Business Consulting 3 Property Management 3 Department & Discount Stores 3 Real Estate Agents 3 Fast Food 3 Bakeries 3 Sporting Goods 2 Golf Courses 2 Thrift & Consignment 2 Insurance 2 BBQ 2

Showing 10 on this page · 179 on the map

Loading map…

Raveill Trucking

Transportation & Shipping · Mcgregor, MN

Not yet reviewed

20982 MN-210, 55760

+12187682701 www.raveilltrucking.com

Minisinaakwaang Leadership Academy

Tutoring & Training · Mcgregor, MN

Not yet reviewed

20930 367th Ln, 55760

12187685320 minisinaakwaangleadershipacademy.com

Jefferson Lines

Government Offices · Mcgregor, MN

Not yet reviewed

123 Country House Ln, 55760

8588008898 www.jeffersonlines.com

Boot Lake Camp

Campgrounds & RV Parks · Mcgregor, MN

Not yet reviewed

58168 Loon Ave, 55760

www.bootlakecamp.com

McGregor Printing & Graphics

Printing & Signs · Mcgregor, MN

Not yet reviewed

171 N Maddy St, 55760

+12187684442 mcgregorprintingandgraphics.com

Grace Lutheran Church

Churches · Mcgregor, MN

Not yet reviewed

48115 Lake Ave, 55760

+12184263343 www.logchurch.org

The Train Station

Gyms & Fitness · Mcgregor, MN

Not yet reviewed

243 MN-210, 55760

Yellowstone Log Homes

Contractors & Builders · Mcgregor, MN

Not yet reviewed

45939 State Highway 65, 55760

+12184264696 www.yellowstoneloghomesofmn-inc.com

AutoSmith Service Group

Towing & Roadside · Mcgregor, MN

Not yet reviewed

95 N Maddy St, 55760

+12187682277 dieselsmith.com

Carefree Living McGregor

Home Health & Senior Care · Mcgregor, MN

Not yet reviewed

22027 420th St, 55760

+12187683356 carefreeliving.com

Previous 1…9 10 11 12 13…22 Next

ZIP codes in Mcgregor

217 listings