NearSpotUSA Add

Categories Locations Saved Add Sign in

Find local businesses in every city and ZIP code across the United States.

Explore

All categories
Browse by state
Search listings
About / data sources

For businesses

Add your business
My listings
Business admin

Your account

Sign in
Saved places
Account

Business data from Overture Maps Foundation (CDLA-Permissive 2.0), the IRS Exempt Organizations BMF (public domain), and OpenStreetMap (© OpenStreetMap contributors, ODbL) — which also provides the map tiles. ZIP code and city data from GeoNames (CC BY 4.0).

© 2026 NearSpotUSA.

Clean Facility Services — Mc Cutchenville, OH | NearSpotUSA

Home/Dry Cleaning & Laundry/Mc Cutchenville/45840

Clean Facility Services

Dry Cleaning & Laundry · Mc Cutchenville, OH

No reviews yet

Call (419) 581-2249 Directions

Loading map…

Reviews

Sign in to write a review.

No reviews yet — be the first to share your experience.

Contact

244 Ash Ave Ste 2, Mc Cutchenville, OH 45840
(419) 581-2249

Location

All listings in Mc Cutchenville
All listings in 45840
All dry cleaning & laundry

Is this your business? Claim or update this listing.

More dry cleaning & laundry nearby

Colonial Laundry

Dry Cleaning & Laundry · Findlay, OH

Not yet reviewed

505 W Trenton Ave, 45840

+14194239362 www.coloniallaundromats.com

Longberry's Paint N Paper

Dry Cleaning & Laundry · Findlay, OH

Call Directions

Not yet reviewed

217 Broadway St, 45840

+14194227732 longberryspaintnpaper.com

Gladine Cleaners

Dry Cleaning & Laundry · Findlay, OH

Not yet reviewed

2215 N Main St, 45840

+14194229268 gladinecleaners.com

Mr Michael's Fine Dry Cleaning

Dry Cleaning & Laundry · Findlay, OH

Not yet reviewed

2032 Tiffin Ave, 45840

+15672944006 mrmichaelsfinedrycleaning.placeweb.site

Time Saver Laundromat

Dry Cleaning & Laundry · Findlay, OH

Not yet reviewed

1012 Tiffin Ave, 45840

+14194245900 timesaverlaundromat2.placeweb.site

Lucky's Laundromat

Dry Cleaning & Laundry · Findlay, OH

Not yet reviewed

411 Ash Ave, 45840

+14194258990 luckyslaundromat.placeweb.site