NearSpotUSA Add

Categories Locations Saved Add Sign in

Find local businesses in every city and ZIP code across the United States.

Explore

All categories
Browse by state
Search listings
About / data sources

For businesses

Add your business
My listings
Business admin

Your account

Sign in
Saved places
Account

Business data from Overture Maps Foundation (CDLA-Permissive 2.0), the IRS Exempt Organizations BMF (public domain), and OpenStreetMap (© OpenStreetMap contributors, ODbL) — which also provides the map tiles. ZIP code and city data from GeoNames (CC BY 4.0).

© 2026 NearSpotUSA.

Campus Nurse — Glenville, WV | NearSpotUSA

Home/Doctors & Clinics/Glenville/26351

Campus Nurse

Doctors & Clinics · Glenville, WV

No reviews yet

Loading map…

Reviews

Sign in to write a review.

No reviews yet — be the first to share your experience.

Contact

Glenville, WV 26351

Location

All listings in Glenville
All listings in 26351
All doctors & clinics

Is this your business? Claim or update this listing.

More doctors & clinics nearby

Minnie Hamilton Health System Glenville Clinic

Doctors & Clinics · Glenville, WV

Not yet reviewed

376 WV Highway 5 E, 26351

+13044627322 www.mhhs.healthcare

Andrew Minigh Dds Of Glenville Inc

Doctors & Clinics · Glenville, WV

Not yet reviewed

809 Mineral Rd, 26351

Joel Roberts

Doctors & Clinics · Glenville, WV

Not yet reviewed

200 High St, 26351

Gilmer County Health Department

Doctors & Clinics · Glenville, WV

Not yet reviewed

809 Medical Dr # 3, 26351

+13044627351 www.gilmerhealthwv.com

Little Kanawha Family Medicine

Doctors & Clinics · Glenville, WV

Not yet reviewed

604 W Main St, 26351

+13044627460 littlekanawhafamilymedicine.placeweb.site

Lucky Eye Care

Doctors & Clinics · Glenville, WV

Not yet reviewed

809 Mineral Rd, 26351

13044628314 www.luckeyeyecare.com