NearSpotUSA Add

Categories Locations Saved Add Sign in

Find local businesses in every city and ZIP code across the United States.

Explore

All categories
Browse by state
Search listings
About / data sources

For businesses

Add your business
My listings
Business admin

Your account

Sign in
Saved places
Account

Business data from Overture Maps Foundation (CDLA-Permissive 2.0), the IRS Exempt Organizations BMF (public domain), and OpenStreetMap (© OpenStreetMap contributors, ODbL) — which also provides the map tiles. ZIP code and city data from GeoNames (CC BY 4.0).

© 2026 NearSpotUSA.

Aldi — Fayetteville, NY | NearSpotUSA

Home/Grocery Stores/Fayetteville/13066

Aldi

Grocery Stores · Fayetteville, NY

No reviews yet

Call +18559552534 Visit website Directions

Loading map…

Reviews

Sign in to write a review.

No reviews yet — be the first to share your experience.

Contact

6820 E Genesee St, Fayetteville, NY 13066
+18559552534
stores.aldi.us/ny/fayetteville/6820-east-genesee-street?utm_source=fb&utm_medium=local&utm_campaign=brand&utm_content=storepage_webclick

Location

All listings in Fayetteville
All listings in 13066
All grocery stores

Is this your business? Claim or update this listing.

More grocery stores nearby

Tops Friendly Markets

Grocery Stores · Fayetteville, NY

Not yet reviewed

350 Towne, 13066

+13156378039 www.topsmarkets.com

Wegmans

Grocery Stores · Fayetteville, NY

Call Directions

Not yet reviewed

6789 E Genesee St, 13066

+13154461180 www.wegmans.com

Olive On Brooklea

Grocery Stores · Fayetteville, NY

Not yet reviewed

205 Brooklea Dr, 13066

(315) 637-2070 www.oliveonbrooklea.com

Jake’s Farm Stand

Grocery Stores · Fayetteville, NY

Not yet reviewed

5186 Highbridge St, 13066

Fayetteville Farmers Market

Grocery Stores · Fayetteville, NY

Not yet reviewed

317 Towne Dr, 13066

fayettevillefarmersmarketcny.com

Tops Friendly Market

Grocery Stores · Fayetteville, NY

Not yet reviewed

350 Towne Dr, 13066